DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and CLIPA9

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:XP_309727.4 Gene:CLIPA9 / 1270989 VectorBaseID:AGAP010968 Length:361 Species:Anopheles gambiae


Alignment Length:244 Identity:58/244 - (23%)
Similarity:100/244 - (40%) Gaps:49/244 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 FKETPW------MAFIASPTKNC---SGTLINKQYVITTASCVFDQSESTVFLGRFDNIPQNRNR 92
            :.|.||      ::|.|:..|..   .|:||:.::|:|.|..:   .:...::.||.....|.:.
Mosquito   115 YGEFPWTVAIFNISFSANEMKLTLVGGGSLIHPKFVLTAAHTL---KKPDRYVARFGEWSINSDA 176

  Fly    93 YVKHS----VQSVYTHKLYNKQ-TFEHDIALLLLDDPVTFKMSIQPICIWLGEITNLNHLESNR- 151
            .:..|    ::....|..|... ..|:||||.:|...|.:...|:|||  |...|::  .:..| 
Mosquito   177 EIYPSQDIGIEEHIIHPSYRDSCLLENDIALAVLKRNVIYTEHIRPIC--LPSPTDV--FDGQRC 237

  Fly   152 ----WGLSEKM-----IFQRINTVKI------LKIKKCRDSFGITLKKSQICAGFQNG-NICTET 200
                |||..:.     |.:||....:      |..::....:...|.:|.:|||.:.| :.|.:.
Mosquito   238 IATGWGLDVRTQQPAPIMKRIELPVVPRDRCQLLYRRAEVDYSFKLHRSMMCAGGEVGEDTCDQD 302

  Fly   201 GSSLVKQIHYSGKLWNTLIGIQSYGVSERC-------IYNKIAHYIDWI 242
            |.:.:......|..  .:.||.|:|:.  |       ||..:|.:..||
Mosquito   303 GGTPLACKKEDGSY--VVAGITSWGLD--CGRVDAPGIYVDVAKFACWI 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 56/240 (23%)
Tryp_SPc 39..242 CDD:304450 56/240 (23%)
CLIPA9XP_309727.4 Tryp_SPc 113..350 CDD:238113 58/244 (24%)
Tryp_SPc 113..347 CDD:214473 56/242 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.