DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and AgaP_AGAP012614

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:XP_306194.4 Gene:AgaP_AGAP012614 / 1267637 VectorBaseID:AGAP012614 Length:393 Species:Anopheles gambiae


Alignment Length:137 Identity:42/137 - (30%)
Similarity:73/137 - (53%) Gaps:24/137 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 QTFEHDIALLLLDDPVTFKMSIQPICIWL-GEITNLNHL----ESNRWG------LSEKMIFQRI 163
            |:..:||||:....||.:..:::|||:.| ..:.|.||:    .:..||      .|||.:...:
Mosquito    10 QSNANDIALIRFTRPVNYSQTVRPICLPLSSSLRNRNHVGMPAYAAGWGKTESATASEKKLKVEM 74

  Fly   164 NTVKILKIKKCRDSF---GITLKKSQICAGFQNG-NICT-ETGSSLVKQIHYSGKLWNTLIGIQS 223
            |   |..:::|...:   ||.||::.:|||...| :.|: ::|..|::|:..|   | .|||:.|
Mosquito    75 N---IKSLQECAPVYQRGGILLKQTHMCAGGVRGKDTCSGDSGGPLMRQMTGS---W-YLIGVVS 132

  Fly   224 YGVSERC 230
            :| .::|
Mosquito   133 FG-PQKC 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 42/137 (31%)
Tryp_SPc 39..242 CDD:304450 42/137 (31%)
AgaP_AGAP012614XP_306194.4 Tryp_SPc <1..149 CDD:214473 42/137 (31%)
Tryp_SPc <1..149 CDD:238113 42/137 (31%)
Tryp_SPc 261..>389 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.