DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and Ctrl

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_446461.1 Gene:Ctrl / 117184 RGDID:621501 Length:264 Species:Rattus norvegicus


Alignment Length:232 Identity:60/232 - (25%)
Similarity:97/232 - (41%) Gaps:42/232 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 PWMAFIASPT--KNCSGTLINKQYVITTASCVFDQSESTVFLGRFDNIPQNRNRYVKHSVQSVYT 103
            ||...:...|  ..|.|:||...:|:|.|.|........|.||.:|. ..|.......|:....|
  Rat    46 PWQVSLQDNTGFHFCGGSLIAPNWVVTAAHCKVTPGRHFVILGEYDR-SSNAEPIQVLSISKAIT 109

  Fly   104 HKLYNKQTFEHDIALLLLDDPVTFKMSIQPICI-----------------WLGEITNLNHLESNR 151
            |..:|..|..:|:.||.|..|..:...:.|:|:                 | |.|:.:.::...|
  Rat   110 HPSWNPNTMNNDLTLLKLASPARYTAQVSPVCLASSNEALPAGLTCVTTGW-GRISGVGNVTPAR 173

  Fly   152 WGLSEKMIFQRINTVKILKIKKCRDSFGITLKKSQICAGFQNGNICT-ETGSSLVKQIHYSGKLW 215
                    .|:: .:.::.:.:||..:|..:..|.||||....:.|. ::|..||.|   .|..|
  Rat   174 --------LQQV-VLPLVTVNQCRQYWGSRITDSMICAGGAGASSCQGDSGGPLVCQ---KGNTW 226

  Fly   216 NTLIGIQSYGVSERC------IYNKIAHYIDWIVGVV 246
             .||||.|:| :|.|      :|.:::.:..||..|:
  Rat   227 -VLIGIVSWG-TENCNVQAPAMYTRVSKFNTWINQVI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 57/226 (25%)
Tryp_SPc 39..242 CDD:304450 57/226 (25%)
CtrlNP_446461.1 Tryp_SPc 33..257 CDD:214473 57/226 (25%)
Tryp_SPc 34..260 CDD:238113 59/229 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.