DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and St14

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_446087.1 Gene:St14 / 114093 RGDID:69288 Length:855 Species:Rattus norvegicus


Alignment Length:236 Identity:55/236 - (23%)
Similarity:103/236 - (43%) Gaps:43/236 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 ETPWMAFIASPTKN--CSGTLINKQYVITTASC-----VFDQSESTV---FLGRFDNIPQNRNRY 93
            |.||...:.:..:.  |..:||:..::::.|.|     :|..|:.|:   |||..|...::.:..
  Rat   625 EWPWQVSLHALGQGHLCGASLISPDWLVSAAHCFQDETIFKYSDHTMWTAFLGLLDQSKRSASGV 689

  Fly    94 VKHSVQSVYTHKLYNKQTFEHDIALLLLDDPVTFKMSIQPIC-------------IWLGEITNLN 145
            .:|.::.:.||..:|..||::|||||.|:.|..:...::|||             ||   :|...
  Rat   690 QEHKLKRIITHPSFNDFTFDYDIALLELEKPAEYSTVVRPICLPDNTHVFPAGKAIW---VTGWG 751

  Fly   146 HLESNRWGLSEKMIFQRINTVKILKIKKCRDSFGITLKKSQICAGFQNGNI--CTETGSSLVKQI 208
            |.:....|   .:|.|: ..::::....|.:.....:....:|.||.:|.:  |.......:..:
  Rat   752 HTKEGGTG---ALILQK-GEIRVINQTTCEELLPQQITPRMMCVGFLSGGVDSCQGDSGGPLSSV 812

  Fly   209 HYSGKLWNTLIGIQSYGVSERC-------IYNKIAHYIDWI 242
            ...|:::..  |:.|:|  |.|       :|.:|....|||
  Rat   813 EKDGRIFQA--GVVSWG--EGCAQRNKPGVYTRIPEVRDWI 849

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 53/234 (23%)
Tryp_SPc 39..242 CDD:304450 53/234 (23%)
St14NP_446087.1 SEA 88..178 CDD:396113
CUB 214..332 CDD:238001
CUB 340..444 CDD:238001
LDLa 454..486 CDD:238060
LDLa 492..523 CDD:238060
LDLa 525..559 CDD:238060
LDLa 567..602 CDD:238060
Tryp_SPc 615..852 CDD:238113 55/236 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.