DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and LOC110439065

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:XP_021329151.1 Gene:LOC110439065 / 110439065 -ID:- Length:251 Species:Danio rerio


Alignment Length:270 Identity:74/270 - (27%)
Similarity:118/270 - (43%) Gaps:50/270 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SLCFLFTLV-----LAHQGSAYFLDFECVNHKPHQDVFKETPWMAFIASPTKN-CSGTLINKQYV 63
            ||..|.:||     .||.|   .:|.:  ..|||     ..|:|..:....:| |:|.||:.::|
Zfish     7 SLLLLVSLVPNLTFTAHVG---IVDGQ--EAKPH-----SRPYMVSVQQFDQNICAGFLISDRFV 61

  Fly    64 ITTASCVFDQSESTVFLGRFD--NIPQNRNRYVKHSVQSVYTHKLYNKQTFEHDIALLLLDDPVT 126
            :|.|.|.....:.||.:|..|  ....::|..||:.:    ||..:|.:|||:||.||.|.:.|.
Zfish    62 LTAAQCWHQNQDLTVVVGAHDLRKRQHSKNFIVKNHI----THPNFNSKTFENDIMLLKLKEKVP 122

  Fly   127 FKMSIQPICI-WLGEITNLNHLES-NRWG-------LSEKMIFQRINTVKILKIKKCRDSFGITL 182
            ....|:||.: ..||....:.|.| ..||       :|:.::..:   ..|:...:|:..:|...
Zfish   123 LNNKIRPISLPKNGESFKADTLCSVAGWGRLWTKGPVSDLLLEAK---TAIVNDAECKLRWGSHY 184

  Fly   183 KKSQICAGFQNGNICT-ETGSSLVKQIHYSGKLWNTLIGIQSYGVSERC-------IYNKIAHYI 239
            ..|.:...|.:|..|. :.|..||..        ||.:|:..:.....|       :|.||:.|:
Zfish   185 VPSMMICAFGHGGSCNGDGGGPLVCN--------NTAVGVTIFRDHYLCNSRLLPNVYTKISVYL 241

  Fly   240 DWIVGVVLNV 249
            .||..::.||
Zfish   242 PWIRSIIGNV 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 58/222 (26%)
Tryp_SPc 39..242 CDD:304450 58/222 (26%)
LOC110439065XP_021329151.1 Tryp_SPc 26..247 CDD:238113 64/242 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.