DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and F11

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_082342.1 Gene:F11 / 109821 MGIID:99481 Length:624 Species:Mus musculus


Alignment Length:247 Identity:65/247 - (26%)
Similarity:102/247 - (41%) Gaps:64/247 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 VFKETPWMAFI-ASPTKNCSGTLINKQYVITTASC---------------VFDQS---ESTVFLG 81
            |..|.||...: .|....|.|::|..|:::|.|.|               :.:||   |.|.|. 
Mouse   397 VHGEWPWQVTLHISQGHLCGGSIIGNQWILTAAHCFSGIETPKKLRVYGGIVNQSEINEGTAFF- 460

  Fly    82 RFDNIPQNRNRYVKHSVQSVYTHKLYNKQTFEHDIALLLLDDPVTFKMSIQPICIWLGEITNLNH 146
                           .||.:..|..|......:|||||.|:..:.:....:|||:......|..|
Mouse   461 ---------------RVQEMIIHDQYTTAESGYDIALLKLESAMNYTDFQRPICLPSKGDRNAVH 510

  Fly   147 LES--NRWGLSE-----KMIFQRINTVKILKIKKCRDSF---GITLKKSQICAGFQNGNICT--- 198
            .|.  ..||.:.     :...|:.. |.::..::|:..:   .||.|  .||||::.|...|   
Mouse   511 TECWVTGWGYTALRGEVQSTLQKAK-VPLVSNEECQTRYRRHKITNK--MICAGYKEGGKDTCKG 572

  Fly   199 ETGSSLVKQIHYSGKLWNTLIGIQSYGVSERC-------IYNKIAHYIDWIV 243
            ::|..|  ...|:| :|: |:||.|:|  |.|       :|..:|.|:|||:
Mouse   573 DSGGPL--SCKYNG-VWH-LVGITSWG--EGCGQKERPGVYTNVAKYVDWIL 618

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 62/241 (26%)
Tryp_SPc 39..242 CDD:304450 62/241 (26%)
F11NP_082342.1 APPLE 20..103 CDD:128519
APPLE 110..193 CDD:128519
APPLE 200..283 CDD:128519
APPLE 291..376 CDD:128519
Tryp_SPc 389..617 CDD:214473 63/244 (26%)
Tryp_SPc 390..617 CDD:238113 63/244 (26%)
Heparin-binding. /evidence=ECO:0000250 547..550 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.