DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and si:dkey-32n7.7

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:XP_021335883.1 Gene:si:dkey-32n7.7 / 108191692 ZFINID:ZDB-GENE-121214-179 Length:609 Species:Danio rerio


Alignment Length:255 Identity:69/255 - (27%)
Similarity:120/255 - (47%) Gaps:48/255 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 PWMAFIA-SPTKNCSGTLINKQYVITTASCVFDQSES---TVFLGRFDNIPQNRNRY----VKHS 97
            ||.|.:. ...:.|.|:||||::|::.|.|...|...   ||.||     |:.:|:|    :..|
Zfish   320 PWQASLYWYSGQTCGGSLINKEWVLSAAHCFNGQRNGFYLTVILG-----PKTQNKYDPSRISRS 379

  Fly    98 VQSVYTHKLYNKQTFEHDIALLLLDDPVTFKMSIQPICI-------------WLGEITNLNHLES 149
            |::|..|..||..|.::||||:.|..|:||..||:|:|:             |:....|:    |
Zfish   380 VKAVIKHPYYNPNTNDNDIALVRLSFPITFTDSIRPVCLAAEGSVFNSDTESWITTWRNI----S 440

  Fly   150 NRWGLSEKMIFQRINTVKILKIKKCRDSFGI-TLKKSQICAGF--QNGNICT-ETGSSLVKQIHY 210
            :...|....|||.:. |.::..::|...:|: ::..:.||||.  :..::|. ::|..:|..   
Zfish   441 DGVPLPSPKIFQEVE-VPVIGNRQCNCLYGVGSITDNMICAGLLKEGKDLCQGDSGGPMVSN--- 501

  Fly   211 SGKLWNTLIGIQSYGVSERC-------IYNKIAHYIDWIVGVVLNVDVILLNSSDSGSDP 263
            ...:| ...||.|:|  ..|       :|.:::.|.:||.....:.....:..:.:|:||
Zfish   502 QSSVW-VQSGIVSFG--SGCAQSEFPGVYTRVSRYQEWITYFTCSDPPGFVQFTSTGADP 558

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 64/232 (28%)
Tryp_SPc 39..242 CDD:304450 64/232 (28%)
si:dkey-32n7.7XP_021335883.1 NIDO 4..63 CDD:310601
NIDO 141..272 CDD:322035
Tryp_SPc 309..537 CDD:238113 64/232 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.