DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and tmprss2.15

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:XP_031752206.1 Gene:tmprss2.15 / 101732233 XenbaseID:XB-GENE-22065943 Length:504 Species:Xenopus tropicalis


Alignment Length:250 Identity:55/250 - (22%)
Similarity:99/250 - (39%) Gaps:79/250 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 PW----MAFIASPTKNCSGTLINKQYVITTASCVFDQSEST-----VFLGRFDNIPQNRNRYVKH 96
            ||    :..:.:....|.|::|...:::|.|.||:. |.||     ||.|..             
 Frog   277 PWQVELLKLVGTSIYLCGGSIITPHWIVTAAHCVYG-STSTPSAFKVFAGSL------------- 327

  Fly    97 SVQSVYT----------HKLYNKQTFEHDIALLLLDDPVTFKMSIQPICI-------------WL 138
            ::||.|:          |..|:..|..:|:|||.|...:.|..:::|:|:             |:
 Frog   328 TIQSYYSAGYTVERALVHPSYSSYTQIYDVALLKLTAALVFTTNLRPVCLPNVGMPWAEGQPCWI 392

  Fly   139 GEITNLNHLESNRWG-------LSEKMIFQRINTVKILKIKKCRDS--FGITLKKSQICAGFQNG 194
                       :.||       :|:.::   ..:|.|:....|..:  :|..:..:.:|||:.:|
 Frog   393 -----------SGWGTTAEGGSISKNLM---AASVPIISSTTCNQAAVYGGAISSTMMCAGYLSG 443

  Fly   195 NICTETGSSLVKQIHYSGKLWNTLIGIQSYGVSERC-------IYNKIAHYIDWI 242
            ...|..|.|....:..:..|| .|:|..|:|..  |       :|..:..:|:||
 Frog   444 GTDTCQGDSGGPLVTKTNSLW-WLVGDTSWGYG--CARAYKPGVYGNVTVFIEWI 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 53/248 (21%)
Tryp_SPc 39..242 CDD:304450 53/248 (21%)
tmprss2.15XP_031752206.1 LDLa 93..121 CDD:238060
SRCR_2 164..259 CDD:406055
Tryp_SPc 265..498 CDD:238113 54/249 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.