DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and LOC101732176

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:XP_031752403.1 Gene:LOC101732176 / 101732176 -ID:- Length:516 Species:Xenopus tropicalis


Alignment Length:235 Identity:56/235 - (23%)
Similarity:92/235 - (39%) Gaps:49/235 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 PW----MAFIASPTKNCSGTLINKQYVITTASCVFDQSESTVFLGRFDNIPQNRNRY-VKHSVQS 100
            ||    |..:.:....|.|::|...:::|.|.||:..:.|......|.......|.| ..:.|..
 Frog   289 PWQISLMKLVGTSLYLCGGSIITPYWIVTAAHCVYGYTSSPSIFKVFAGSLTLSNYYSAGYLVDR 353

  Fly   101 VYTHKLYNKQTFEHDIALLLLDDPVTFKMSIQPICI-------------WLGEITNLNHLESNRW 152
            |..|..|:..|..:|||||.|...:.|..:::|:|:             |:           :.|
 Frog   354 VLIHPSYSPNTQNYDIALLKLKTALVFSTNLRPVCLPNVGMPWADGQPCWI-----------SGW 407

  Fly   153 GLSEKMIFQRINT------VKILKIKKCR--DSFGITLKKSQICAGFQNGNICTETGSSLVKQIH 209
            |.:.:.  ..|:|      |.|:....|.  ..:|..:..:.||||:..|...|..|.|....:.
 Frog   408 GTTSEA--GSISTSLKAASVPIISSATCNLAPVYGGVISPTMICAGYLGGGTDTCQGDSGGPLVT 470

  Fly   210 YSGKLWNTLIGIQSYGVSERC-------IYNKIAHYIDWI 242
            .:..|| .|:|..|:|..  |       :|..|..:::||
 Frog   471 KTNSLW-WLVGDTSWGYG--CARAYKPGVYGNITVFLEWI 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 54/233 (23%)
Tryp_SPc 39..242 CDD:304450 54/233 (23%)
LOC101732176XP_031752403.1 LDLa <115..133 CDD:238060
LDLa 140..171 CDD:238060
SRCR_2 176..271 CDD:406055
Tryp_SPc 277..510 CDD:238113 56/235 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.