DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and prss56

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:XP_017949880.1 Gene:prss56 / 101731690 XenbaseID:XB-GENE-6051085 Length:665 Species:Xenopus tropicalis


Alignment Length:227 Identity:65/227 - (28%)
Similarity:107/227 - (47%) Gaps:34/227 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 PWMAFIA-SPTKNCSGTLINKQYVITTASCVFDQSES----TVFLGRFDNIPQNRNRYVKHSVQS 100
            ||:..|. :....|.|.|::..:::|.|.| |..|.:    ||.:|::| :.:|........|..
 Frog    87 PWLVNIRFNGELMCGGVLLDDMWILTAAHC-FTGSVNEVLWTVVVGQYD-LTKNAQGEKTFQVNR 149

  Fly   101 VYTHKLYNKQTFEHDIALLLLDDPVTFKMSIQPICI--WLGEITNLNHLESNRWG-------LSE 156
            :.||..:|::||::|:|||.|...||...|.:|:|:  ...:.|...:.....||       ||:
 Frog   150 IVTHPKFNQKTFDNDLALLELTSSVTASQSARPVCLPPVPRDPTPGTNCYIAGWGSLYEDGPLSD 214

  Fly   157 KMIFQRINTVKILKIKKCRDSFGIT-LKKSQICAGFQNGNI--CT-ETGSSLVKQIHYSGKLWNT 217
            .::..|   |.:|..:.||.:.|.. |..:..|||:.||.|  |. ::|..|..|...|.:.  .
 Frog   215 VIMEAR---VPVLSQEACRSTLGKNMLTSTMFCAGYLNGGIDSCQGDSGGPLTCQDPISKQY--V 274

  Fly   218 LIGIQSYGVSERC-------IYNKIAHYIDWI 242
            |.||.|:|  :.|       :|.::..:.|||
 Frog   275 LYGITSWG--DGCGERGKPGVYTRVTAFTDWI 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 63/225 (28%)
Tryp_SPc 39..242 CDD:304450 63/225 (28%)
prss56XP_017949880.1 Tryp_SPc 75..305 CDD:238113 65/227 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.