DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and tmprss3

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:XP_031752328.1 Gene:tmprss3 / 100490444 XenbaseID:XB-GENE-994580 Length:483 Species:Xenopus tropicalis


Alignment Length:240 Identity:64/240 - (26%)
Similarity:98/240 - (40%) Gaps:62/240 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 PWMA-FIASPTKNCSGTLINKQYVITTASCVFD---QSESTVFLGRFDNIPQNRNRYVKHSVQSV 101
            ||.| .:......|.|:||..|:::|.|.||:|   .....|.:|:.....::....|  .||.:
 Frog   256 PWQASLVFQGVHLCGGSLITPQWIVTAAHCVYDLLYPEWWRVQVGQVSQASESAQTAV--PVQKI 318

  Fly   102 YTHKLYNKQTFEHDIALLLLDDPVTFKMSIQPICI-------------WLGEITNLNHLESNRWG 153
            ..|..|...|..:||||:.|..|.||..||||||:             |:           :.||
 Frog   319 IYHSKYRSSTMANDIALIRLASPFTFNGSIQPICLPNYREDFPEGKICWI-----------SGWG 372

  Fly   154 LSEK--------------MIFQRINTVKILKIKKCRDSFGITLKKSQICAGFQNGNICTETGSSL 204
            .:|:              :|..|:...|.:        :|..:|.|.:||||..|.:.|..|.|.
 Frog   373 ATEEGGDTSQTMDYAGVPLISNRVCNTKYI--------YGGVIKPSMVCAGFLEGGVDTCQGDSG 429

  Fly   205 VKQIHYSGKLWNTLIGIQSYGVSERC-------IYNKIAHYIDWI 242
            .........:|. |:|..|:|:.  |       :|.:|:.::|||
 Frog   430 GPLACEDSNVWK-LMGTTSWGIG--CALRYKPGVYTRISSFLDWI 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 62/238 (26%)
Tryp_SPc 39..242 CDD:304450 62/238 (26%)
tmprss3XP_031752328.1 LDLa 96..128 CDD:197566
SRCR_2 136..236 CDD:406055
Tryp_SPc 244..472 CDD:238113 64/240 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.