DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and tmprss15

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:XP_031752048.1 Gene:tmprss15 / 100490249 XenbaseID:XB-GENE-999987 Length:994 Species:Xenopus tropicalis


Alignment Length:229 Identity:51/229 - (22%)
Similarity:100/229 - (43%) Gaps:28/229 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 PW-MAFIASPTKNCSGTLINKQYVITTASCVFDQ----SESTVFLGRFDNIPQNRNRYVKHSVQS 100
            || ::...:..:.|..:|:|::::::.|.||:.:    |.....||...|:...:.:.....:..
 Frog   772 PWIVSLYYNDRQTCGASLVNQEWLVSAAHCVYGRNLIPSNWKARLGLHTNLNLTQPQIATQMIDQ 836

  Fly   101 VYTHKLYNKQTFEHDIALLLLDDPVTFKMSIQPICIWLGEITNLNHLESN----RWGLSEK---- 157
            :..:..||::|.:.||.::.|...|.:...|||||  |.|......:..|    .||.::.    
 Frog   837 IVINPQYNRRTKDSDIVMMHLQFKVNYSDYIQPIC--LPETDQEFSVGINCSIAGWGRTQSGGPV 899

  Fly   158 -MIFQRINTVKILKIKKCRD---SFGITLKKSQICAGFQNGNICTETGSSLVKQIHYSGKLWNTL 218
             .|.|... :.::...||:.   .:.||  .:.:|.|::.|.|.|..|.|....:......| .|
 Frog   900 PNILQEAE-IPLISNHKCQQQMPEYNIT--DNMVCGGYEEGGIDTCQGDSGGPMMCQQNNEW-FL 960

  Fly   219 IGIQSYGV-----SERCIYNKIAHYIDWIVGVVL 247
            :|:.|:|.     |...:|.::..:.:||...::
 Frog   961 VGVTSFGYGCAQPSRPGVYVRVTEFTNWIKSFII 994

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 49/222 (22%)
Tryp_SPc 39..242 CDD:304450 49/222 (22%)
tmprss15XP_031752048.1 SEA 36..>103 CDD:396113
LDLa 157..190 CDD:197566
CUB 199..305 CDD:238001
MAM 321..478 CDD:395504
CUB 501..608 CDD:395345
LDLa 620..654 CDD:238060
SR 655..746 CDD:214555
Tryp_SPc 760..991 CDD:238113 51/224 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.