DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and tmprss15

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:XP_001919639.2 Gene:tmprss15 / 100148042 ZFINID:ZDB-GENE-091204-83 Length:990 Species:Danio rerio


Alignment Length:238 Identity:67/238 - (28%)
Similarity:106/238 - (44%) Gaps:56/238 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 PWMAFIA-SPTKNCSGTLINKQYVITTASCVFDQ----SESTVFLG---RFDNIPQNRNRYVKHS 97
            |||..:. .....|..|||:::::||.|.||:.:    |.....||   :|:.|..|:..:   |
Zfish   760 PWMVSLQWLGGHACGATLIDREWLITAAHCVYGRNVQLSNWAAVLGLHAQFETINPNKQVF---S 821

  Fly    98 VQSVYTHKLYNKQTFEHDIALLLLDDPVTFKMSIQPICIWLGEITNLNHLESNR------WGLSE 156
            |..|..||.|||:|.|.|.||:.|..||::...:||||:    .....|.|..|      |||..
Zfish   822 VDQVIMHKHYNKRTKESDFALMHLKTPVSYTDYVQPICL----PDPGAHFEEGRKCFIAGWGLLS 882

  Fly   157 KM-----IFQRINTVKILKIKKCRD---SFGITLKKSQICAGFQNGNICTETGSSLVKQIHYSGK 213
            :.     :.|:. .|.:|...:|::   .:..|  :..:|||:..|.:.|..|.|       .|.
Zfish   883 ESGLKADVLQQA-VVPLLSNTQCQEWLPEYNFT--ERMMCAGYAEGGVDTCQGDS-------GGP 937

  Fly   214 L-------WNTLIGIQSYGVSERC-------IYNKIAHYIDWI 242
            |       | .|:|..|:|:.  |       .|.:::.::||:
Zfish   938 LMCEEEGHW-VLVGATSFGIG--CGRPQRPGAYARVSQFVDWV 977

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 66/236 (28%)
Tryp_SPc 39..242 CDD:304450 66/236 (28%)
tmprss15XP_001919639.2 SEA 19..>89 CDD:279699
LDLa 142..175 CDD:238060
CUB 183..288 CDD:238001
MAM 302..457 CDD:279023
MAM 302..457 CDD:99706
CUB 477..586 CDD:238001
LDLa 596..630 CDD:238060
SRCR_2 653..728 CDD:295335
Tryp_SPc 747..977 CDD:214473 66/236 (28%)
Tryp_SPc 748..980 CDD:238113 67/238 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.