DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and proc.2

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001120289.1 Gene:proc.2 / 100145345 XenbaseID:XB-GENE-5882297 Length:681 Species:Xenopus tropicalis


Alignment Length:241 Identity:60/241 - (24%)
Similarity:111/241 - (46%) Gaps:44/241 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 ETPWMAFIASPTKN------CSGTLINKQYVITTASCVFDQSESTVFLGRFDNIPQNRNRYVKHS 97
            :.||...|    :|      |.|:||:.::|::.|.|...|....|.:|.:|...::.:.. |.:
 Frog   446 QCPWQVLI----RNNRGFGFCGGSLISSRWVLSAAHCFESQIPHHVTIGDYDTYRRDMDEQ-KIA 505

  Fly    98 VQSVYTHKLYNKQTFEHDIALLLLDDPVTFKMSIQPICI---WLGEITNLNHL--ESNRWGLSEK 157
            |..|::|..|..:.::||||||.|..|..|....:|||:   .||::......  :.:.||.:.:
 Frog   506 VLQVFSHPNYLAEFYDHDIALLFLRSPAMFGEYSRPICLPNPGLGKMLTQEGQTGQVSGWGATRQ 570

  Fly   158 M-IFQRINTVKILKIK-------KCRDSFGITLKKSQICAGFQNG--NICT-ETGSSLVKQIHYS 211
            . .:.|.    :||::       .|..|....|..:..|||::.|  :.|: ::|.......|  
 Frog   571 FGPYTRF----LLKVRLPIVSQETCMASTENILTGNMFCAGYKEGVKDACSGDSGGPFAVLFH-- 629

  Fly   212 GKLWNTLIGIQSYGVSERC-------IYNKIAHYIDWIVGVVLNVD 250
             ..| .|:|:.|:|  :.|       :|.::|:|:.||...::.::
 Frog   630 -DTW-FLVGVVSWG--DGCAEKGKYGVYTRVANYMPWIKETIVEIE 671

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 58/231 (25%)
Tryp_SPc 39..242 CDD:304450 58/231 (25%)
proc.2NP_001120289.1 GLA 19..80 CDD:214503
EGF_CA 81..117 CDD:238011
FXa_inhibition 123..160 CDD:373209
Tryp_SPc 436..666 CDD:238113 60/234 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.