DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34437 and si:dkey-16l2.17

DIOPT Version :9

Sequence 1:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster
Sequence 2:XP_001341498.1 Gene:si:dkey-16l2.17 / 100001520 ZFINID:ZDB-GENE-141212-262 Length:305 Species:Danio rerio


Alignment Length:232 Identity:56/232 - (24%)
Similarity:101/232 - (43%) Gaps:43/232 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 PWMAFIASPTKN--CSGTLINKQYVITTASCVFDQSE---STVFLGRFDNIPQNRNRYVKHS-VQ 99
            ||...|...:..  |.|::|.|.:|::.|.|..:.||   .|:::||  ::....|::.|.| ||
Zfish    44 PWQVDIQMGSNGHVCGGSIIAKNWVLSAAHCFPNPSEVSAYTLYMGR--HLLNGYNQFEKVSYVQ 106

  Fly   100 SVYTHKLYNKQTFEHDIALLLLDDPVTFKMSIQPICIWLGE----------ITNLNHLESNRWGL 154
            .|...:.|.......|:||:.|..||::...|||:|:...:          :|...|.:.. ..|
Zfish   107 RVVIPEGYTDPQGGRDVALVQLRAPVSWTDRIQPVCLPFADFQFNSGTLCYVTGWGHKQEG-VSL 170

  Fly   155 SEKMIFQRINTVKILKIKKCR--------DSFGITLKKSQICAGFQNG--NICT-ETGSSLVKQI 208
            :.....:.:. |.|:....|:        ||..:.:....||||::.|  :.|. ::|..||..:
Zfish   171 TGAAALREVE-VPIIDQSSCQFMYQILSSDSSTVDILSDMICAGYKEGGKDSCQGDSGGPLVCPV 234

  Fly   209 HYSGKLWNTLIGIQSYGVSERC-------IYNKIAHY 238
              ....| ...|:.|:|:.  |       ||::::.:
Zfish   235 --GNGTW-IQAGVVSFGLG--CAQKNRPGIYSRVSSF 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 56/232 (24%)
Tryp_SPc 39..242 CDD:304450 56/232 (24%)
si:dkey-16l2.17XP_001341498.1 Tryp_SPc 32..273 CDD:238113 56/232 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.