DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drgx and HB-2

DIOPT Version :10

Sequence 1:NP_001097075.2 Gene:Drgx / 5740176 FlyBaseID:FBgn0085369 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_193411.1 Gene:HB-2 / 827384 AraportID:AT4G16780 Length:284 Species:Arabidopsis thaliana


Alignment Length:92 Identity:24/92 - (26%)
Similarity:38/92 - (41%) Gaps:37/92 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 AIHDETFVRRKQRRNRTTFTLQQLEELETAFAQTHYPDVFTREDLAMKINLTEARVQVWFQNRRA 105
            ||.:|||      ::.:|...:|                  ::.||.::.|...:|:||||||||
plant   139 AILEETF------KDHSTLNPKQ------------------KQALAKQLGLRARQVEVWFQNRRA 179

  Fly   106 KW-------------RKAERLKDEQRK 119
            :.             |..|.|.:|.|:
plant   180 RTKLKQTEVDCEFLRRCCENLTEENRR 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DrgxNP_001097075.2 Homeodomain 53..109 CDD:459649 14/68 (21%)
OAR 428..446 CDD:461067
HB-2NP_193411.1 HD-ZIP_N 8..107 CDD:461370
HOX 128..182 CDD:197696 19/66 (29%)
HALZ 184..227 CDD:128634 5/23 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.