DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drgx and HB-12

DIOPT Version :10

Sequence 1:NP_001097075.2 Gene:Drgx / 5740176 FlyBaseID:FBgn0085369 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_191748.1 Gene:HB-12 / 825362 AraportID:AT3G61890 Length:235 Species:Arabidopsis thaliana


Alignment Length:158 Identity:35/158 - (22%)
Similarity:70/158 - (44%) Gaps:8/158 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 RRKQRRNRTTFTLQQLEELETAFAQTHYPDVFTREDLAMKINLTEARVQVWFQNRRAKWRKAERL 113
            :.|:..|:..|:.:|::.||..|......:...:..:|.::.|...:|.:||||:||:|:..:..
plant    24 KMKKSNNQKRFSEEQIKSLELIFESETRLEPRKKVQVARELGLQPRQVAIWFQNKRARWKTKQLE 88

  Fly   114 KDEQRKREN-GESSSSLDKLHDSRESSPDITGEIDDDMDDLPPRQRSHSPLANGQMEQQHSHSHS 177
            |:....|.| ...:|..:.:...::|.......::::|.  .|::..|......|.....|.:.|
plant    89 KEYNTLRANYNNLASQFEIMKKEKQSLVSELQRLNEEMQ--RPKEEKHHECCGDQGLALSSSTES 151

  Fly   178 HSHSRSPGGGMHLDSSD---NERPLSSN 202
            |:....|.|  .||...   |:...::|
plant   152 HNGKSEPEG--RLDQGSVLCNDGDYNNN 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DrgxNP_001097075.2 Homeodomain 53..109 CDD:459649 16/55 (29%)
OAR 428..446 CDD:461067
HB-12NP_191748.1 Homeodomain 33..83 CDD:459649 14/49 (29%)
HALZ 85..126 CDD:460477 5/40 (13%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.