DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drgx and HB20

DIOPT Version :10

Sequence 1:NP_001097075.2 Gene:Drgx / 5740176 FlyBaseID:FBgn0085369 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_186771.1 Gene:HB20 / 821232 AraportID:AT3G01220 Length:286 Species:Arabidopsis thaliana


Alignment Length:183 Identity:39/183 - (21%)
Similarity:65/183 - (35%) Gaps:65/183 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 TFVRRKQRRNRTTFTLQQLEELETAFAQTHYPDVFTREDLAMKINLTEARVQVWFQNRRAKW--R 108
            |.:..|::|    ..|:|::.||.:|...:..:...:..||..:.:...::.:|||||||:|  |
plant    82 TMLGEKKKR----LQLEQVKALEKSFELGNKLEPERKIQLAKALGMQPRQIAIWFQNRRARWKTR 142

  Fly   109 KAERLKDEQRKR---------------------------------------------ENGESSSS 128
            :.||..|..:|:                                             .||.:.:|
plant   143 QLERDYDSLKKQFESLKSDNASLLAYNKKLLAEVMALKNKECNEGNIVKREAEASWSNNGSTENS 207

  Fly   129 LD-KLHDSRESSPDITGEIDDDMDDLPPRQRSHSPLANGQMEQQHSHSHSHSH 180
            .| .|...||:   ||..::...|..|...||.:          |...|..:|
plant   208 SDINLEMPRET---ITTHVNTIKDLFPSSIRSSA----------HDDDHHQNH 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DrgxNP_001097075.2 Homeodomain 53..109 CDD:459649 16/57 (28%)
OAR 428..446 CDD:461067
HB20NP_186771.1 Homeodomain 87..140 CDD:459649 16/56 (29%)
HALZ 142..183 CDD:460477 5/40 (13%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.