DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drgx and Rhox13

DIOPT Version :10

Sequence 1:NP_001097075.2 Gene:Drgx / 5740176 FlyBaseID:FBgn0085369 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001171931.1 Gene:Rhox13 / 73614 MGIID:1920864 Length:232 Species:Mus musculus


Alignment Length:96 Identity:41/96 - (42%)
Similarity:54/96 - (56%) Gaps:7/96 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 PPRLPTLDYPFAATHPYTSYSYHPAIHDETFVRRKQRRNRTTFTLQQLEELETAFAQTHYPDVFT 81
            ||.:|..    ||......|.|.|   ....|||::|.....|...|:||:|:.|.:|.|||:.|
Mouse   120 PPTVPAA----AAIQIPGPYRYRP---PRRHVRRRRRGPPFHFAQWQVEEMESLFEETQYPDLLT 177

  Fly    82 REDLAMKINLTEARVQVWFQNRRAKWRKAER 112
            |.:||..:|:.|.:|:|||.|||||.||.||
Mouse   178 RGELARTLNVPEVKVKVWFTNRRAKQRKIER 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DrgxNP_001097075.2 Homeodomain 53..109 CDD:459649 26/55 (47%)
OAR 428..446 CDD:461067
Rhox13NP_001171931.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 45..114
Homeodomain 155..205 CDD:459649 25/49 (51%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.