DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drgx and Isx

DIOPT Version :9

Sequence 1:NP_001097075.2 Gene:Drgx / 5740176 FlyBaseID:FBgn0085369 Length:587 Species:Drosophila melanogaster
Sequence 2:XP_008770554.1 Gene:Isx / 682968 RGDID:1592776 Length:242 Species:Rattus norvegicus


Alignment Length:198 Identity:66/198 - (33%)
Similarity:88/198 - (44%) Gaps:32/198 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 PTLDYPFAATHPYTSYSYHPAIHDETFVRRKQRRNRTTFTLQQLEELETAFAQTHYPDVFTREDL 85
            ||.|.|                .:|   |:.:||.|||||.:||:|||..|..|||||:..|..|
  Rat    66 PTQDQP----------------QEE---RKNKRRVRTTFTTEQLQELEKLFHFTHYPDIHVRSQL 111

  Fly    86 AMKINLTEARVQVWFQNRRAKWRKAERLKDEQRKRENGESSSSLDKLH--DSRESSPDITGEIDD 148
            |.:|||.|||||:||||:||||||.|:.......::.|..:.:....|  .:....|.::   |.
  Rat   112 ASRINLPEARVQIWFQNQRAKWRKQEKSGSLSAPQQPGSCTDAHCSAHIGATHRMLPPLS---DS 173

  Fly   149 DMDDLPPRQRSHSPLANGQMEQQHSHSHS-------HSHSRSPGGGMHLDSSDNERPLS-SNQLT 205
            ....|.|...|..|:|..........||.       |..:..|..|.||.:::.....| ..|.|
  Rat   174 ARFKLVPCPDSPCPMAPMGPAAPAWPSHPAALCPYLHPPTPKPQVGQHLCNANIRTGFSLPKQAT 238

  Fly   206 ATP 208
            ..|
  Rat   239 LLP 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DrgxNP_001097075.2 Homeobox 56..108 CDD:278475 34/51 (67%)
OAR 428..445 CDD:281777
IsxXP_008770554.1 Homeobox 82..134 CDD:278475 34/51 (67%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.