powered by:
Protein Alignment Drgx and Rhox10
DIOPT Version :9
Sequence 1: | NP_001097075.2 |
Gene: | Drgx / 5740176 |
FlyBaseID: | FBgn0085369 |
Length: | 587 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001032670.1 |
Gene: | Rhox10 / 652926 |
RGDID: | 1563291 |
Length: | 201 |
Species: | Rattus norvegicus |
Alignment Length: | 54 |
Identity: | 27/54 - (50%) |
Similarity: | 37/54 - (68%) |
Gaps: | 0/54 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 59 FTLQQLEELETAFAQTHYPDVFTREDLAMKINLTEARVQVWFQNRRAKWRKAER 112
||..||.|||.||.:|.|||...|:.||..|::.|.:|:.||:|:|||:||..:
Rat 99 FTYAQLCELEKAFQETQYPDAHRRKALAALIHVDECKVKAWFKNKRAKYRKKHK 152
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Drgx | NP_001097075.2 |
Homeobox |
56..108 |
CDD:278475 |
25/48 (52%) |
OAR |
428..445 |
CDD:281777 |
|
Rhox10 | NP_001032670.1 |
Homeobox |
99..148 |
CDD:278475 |
25/48 (52%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.