DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drgx and hoxc6b

DIOPT Version :10

Sequence 1:NP_001097075.2 Gene:Drgx / 5740176 FlyBaseID:FBgn0085369 Length:587 Species:Drosophila melanogaster
Sequence 2:XP_073772180.1 Gene:hoxc6b / 58045 ZFINID:ZDB-GENE-000822-1 Length:228 Species:Danio rerio


Alignment Length:98 Identity:31/98 - (31%)
Similarity:47/98 - (47%) Gaps:20/98 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 QRRNRTTFTLQQLEELETAFAQTHYPDVFTRE---DLAMKINLTEARVQVWFQNRRAKWRKAERL 113
            :||.|..::..|..|||..|   ||....||.   ::|..:.|:|.::::||||||.||:|...|
Zfish   136 RRRGRQIYSRYQTLELEKEF---HYNRYLTRRRRIEIANTLCLSERQIKIWFQNRRMKWKKESNL 197

  Fly   114 K------------DEQRKRENGESSSSLDKLHD 134
            .            .:..|.|.||::...:  ||
Zfish   198 TSILNDNGSVGAGQDTDKEETGETAEKDE--HD 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DrgxNP_001097075.2 Homeodomain 53..109 CDD:459649 23/58 (40%)
OAR 428..446 CDD:461067
hoxc6bXP_073772180.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.