DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drgx and alx4b

DIOPT Version :9

Sequence 1:NP_001097075.2 Gene:Drgx / 5740176 FlyBaseID:FBgn0085369 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001297007.1 Gene:alx4b / 497424 ZFINID:ZDB-GENE-050208-140 Length:259 Species:Danio rerio


Alignment Length:113 Identity:38/113 - (33%)
Similarity:53/113 - (46%) Gaps:16/113 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   347 RSANHPPLFLPPHLAAQFTHQPLFPGLKGVSPFQSLCSCCSLKPPPPPGSSVVAPLSIPVSSSSA 411
            |..|:..:..|..|:...:..|: ||.  |.|..::.||  :.|.|...|.|...|.:|....|.
Zfish   148 RPENYAQIQNPSWLSGSSSASPV-PGC--VVPCDTVSSC--MTPHPHSASGVSDFLGMPSPGGSM 207

  Fly   412 ASSPESP--KSSGQG--------SVH-DPRSNSVAELRRKAQEHSAAL 448
            |.:....  .|||.|        ||. |.:|:|:|.||.||:|||||:
Zfish   208 AQTHMGSLFGSSGVGGTINGYDLSVEPDRKSSSIASLRMKAKEHSAAI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DrgxNP_001097075.2 Homeobox 56..108 CDD:278475
OAR 428..445 CDD:281777 9/16 (56%)
alx4bNP_001297007.1 OAR 235..252 CDD:281777 9/16 (56%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D454642at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.