DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drgx and hbn

DIOPT Version :9

Sequence 1:NP_001097075.2 Gene:Drgx / 5740176 FlyBaseID:FBgn0085369 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_788420.1 Gene:hbn / 47894 FlyBaseID:FBgn0008636 Length:409 Species:Drosophila melanogaster


Alignment Length:331 Identity:102/331 - (30%)
Similarity:133/331 - (40%) Gaps:109/331 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 RKQRRNRTTFTLQQLEELETAFAQTHYPDVFTREDLAMKINLTEARVQVWFQNRRAKWRKAERLK 114
            ||.||:|||||..||.:||.||.:|.||||||||||||:::|:|||||||||||||||||.|:..
  Fly   151 RKVRRSRTTFTTFQLHQLERAFEKTQYPDVFTREDLAMRLDLSEARVQVWFQNRRAKWRKREKFM 215

  Fly   115 DEQRK----RENGESSSSLDKLHDSRESSPDITGEIDDDMDDLPPRQRSHSPLANGQMEQQ---- 171
            ::.:.    .|.|               .|:....|     .|||......|   |.|:.:    
  Fly   216 NQDKAGYLLPEQG---------------LPEFPLGI-----PLPPHGLPGHP---GSMQSEFWPP 257

  Fly   172 HSHSHSH-SHSRSPGGGM---HLDSSDNERP-----LS-----SNQLTATPHSASQSLGSISAGS 222
            |...|.| :.:.:...|:   ||.:...:.|     ||     ||........|:.:..:.|||.
  Fly   258 HFALHQHFNPAAAAAAGLLPQHLMAPHYKLPNFHTLLSQYMGLSNLNGIFGAGAAAAAAAASAGY 322

  Fly   223 PSPSGMHREREHTPLVGGGGQGPSSP--SNSRNTDSPIEVGGPMSLTTGSRMAASSNNSASSTPT 285
            |....:|        .|.......||  |||...:||                       ...|.
  Fly   323 PQNLSLH--------AGLSAMSQVSPPCSNSSPRESP-----------------------KLVPH 356

  Fly   286 PTTPHAPQMPHSSAAAAAAFGSHIFGNFGGGSNASDSNCGFRPVLSEQSAVAAAA----AAAAAQ 346
            ||.|||  .|.:.            ||.|||             |.....::.||    :||.|.
  Fly   357 PTPPHA--TPPAG------------GNGGGG-------------LLTGGLISTAAQSPNSAAGAS 394

  Fly   347 RSANHP 352
            .:|:.|
  Fly   395 SNASTP 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DrgxNP_001097075.2 Homeobox 56..108 CDD:278475 39/51 (76%)
OAR 428..445 CDD:281777
hbnNP_788420.1 Homeobox 156..209 CDD:278475 39/52 (75%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 55 1.000 Domainoid score I4097
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D143142at50557
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24329
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.