DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drgx and repo

DIOPT Version :9

Sequence 1:NP_001097075.2 Gene:Drgx / 5740176 FlyBaseID:FBgn0085369 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_477026.1 Gene:repo / 47285 FlyBaseID:FBgn0011701 Length:612 Species:Drosophila melanogaster


Alignment Length:363 Identity:96/363 - (26%)
Similarity:127/363 - (34%) Gaps:107/363 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 KQRRNRTTFTLQQLEELETAFAQTHYPDVFTREDLAMKINLTEARVQVWFQNRRAKWRKAERLKD 115
            |:::.|||||..||||||.||.:..|||||.||:||:|:||:|:|||||||||||||||.|    
  Fly   303 KKKKTRTTFTAYQLEELERAFERAPYPDVFAREELAIKLNLSESRVQVWFQNRRAKWRKHE---- 363

  Fly   116 EQRKRENGESSSSLDKLHDSRESSPDIT---GEIDDDMDDLPPRQRSHSPLANGQMEQQHSHSHS 177
              ..|:.|...:|         :.|..|   |.:.......|.......|   |.|:...|:...
  Fly   364 --PPRKTGYIKTS---------TPPTATLNPGTLAPPFTSYPQTTTVTPP---GSMDSWTSYQTP 414

  Fly   178 H---------SHSRSPGGGMHLDSSDNERPLSSNQLTATPHSASQ-SLGSISAGSPSPSGMHRER 232
            :         |.:.||.|            ..|.|..|..|.:.. .:.....|||:...|    
  Fly   415 YELTPQFSLLSPAASPYG------------TYSGQYGAYVHESQLFPMRHYEYGSPTRMEM---- 463

  Fly   233 EHTPLVGGGGQGPSSPSNSRNTDSPIEVGGPMSLTTGSRMAASSNNSASSTPTPTTPHAPQM--- 294
                       |.::.|.:.|.|..:..||  |..|.....|.....|..|......|..|.   
  Fly   464 -----------GATTGSVAGNGDESVANGG--SYQTAELQTAQQQQLADGTLVTVHAHQQQQQQQ 515

  Fly   295 ------------------------------PHSSAAAAAAFGSHIF-----GNFGGGSNASDSN- 323
                                          |.:|.....|.|.|..     |....|..:||.| 
  Fly   516 QQLNGKYLSAEEAKYVHLQCHQSGGGLELSPGASCHLVEAQGQHYVTTATGGAASAGGTSSDDND 580

  Fly   324 -CGFRPVLSEQSAVAAAAAAAAAQRSANHPPLFLPPHL 360
             .|.:.|:..:.       .:..|:........|||.|
  Fly   581 SGGMQTVIKSEE-------VSQQQQQQQGQSYVLPPFL 611

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DrgxNP_001097075.2 Homeobox 56..108 CDD:278475 38/51 (75%)
OAR 428..445 CDD:281777
repoNP_477026.1 Homeobox 313..360 CDD:278475 33/46 (72%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 55 1.000 Domainoid score I4097
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24329
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.