DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drgx and btn

DIOPT Version :10

Sequence 1:NP_001097075.2 Gene:Drgx / 5740176 FlyBaseID:FBgn0085369 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_732768.1 Gene:btn / 42664 FlyBaseID:FBgn0014949 Length:158 Species:Drosophila melanogaster


Alignment Length:73 Identity:27/73 - (36%)
Similarity:47/73 - (64%) Gaps:3/73 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 RRNRTTFTLQQLEELETAFAQTHYPDVFTREDLAMKINLTEARVQVWFQNRRAKWRKAERLKDEQ 117
            |:.||.|:..||::||..|..::|.....|.::|:.:.|||.:|:|||||||   .|.:|:|.|:
  Fly    87 RKERTAFSKTQLKQLEAEFCYSNYLTRLRRYEIAVALELTERQVKVWFQNRR---MKCKRIKLEE 148

  Fly   118 RKRENGES 125
            ::..:.::
  Fly   149 QQGSSAKT 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DrgxNP_001097075.2 Homeodomain 53..109 CDD:459649 23/55 (42%)
OAR 428..446 CDD:461067
btnNP_732768.1 Homeodomain 87..143 CDD:459649 24/58 (41%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.