DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drgx and ftz

DIOPT Version :10

Sequence 1:NP_001097075.2 Gene:Drgx / 5740176 FlyBaseID:FBgn0085369 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_477498.1 Gene:ftz / 40834 FlyBaseID:FBgn0001077 Length:410 Species:Drosophila melanogaster


Alignment Length:190 Identity:52/190 - (27%)
Similarity:77/190 - (40%) Gaps:56/190 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 DETFVR--RKQRRNRTTFTLQQLEELETAFAQTHYPDVFTRE---DLAMKINLTEARVQVWFQNR 103
            :||...  :..:|.|.|:|..|..|||..|   |:....||.   |:|..::|:|.::::|||||
  Fly   244 EETLASDCKDSKRTRQTYTRYQTLELEKEF---HFNRYITRRRRIDIANALSLSERQIKIWFQNR 305

  Fly   104 RAKWRKAERLKDEQRKRENGESSSSLDKLHDSRESSPDITGEIDDDMDDLPPRQRSH-----SPL 163
            |.|.:|...|                       :|||:..|.....|  |||.:.:.     :|.
  Fly   306 RMKSKKDRTL-----------------------DSSPEHCGAGYTAM--LPPLEATSTATTGAPS 345

  Fly   164 ANGQMEQQH-------SHSHSHSHSRSPGGGMHLDSSDNERPLSSNQLTATP----HSAS 212
            ....|...|       ::||||||    |.|:   .:|..:..:..|..|.|    |..|
  Fly   346 VPVPMYHHHQTTAAYPAYSHSHSH----GYGL---LNDYPQQQTHQQYDAYPQQYQHQCS 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DrgxNP_001097075.2 Homeodomain 53..109 CDD:459649 23/58 (40%)
OAR 428..446 CDD:461067
ftzNP_477498.1 FTZ 1..248 CDD:397787 2/3 (67%)
Homeodomain 255..311 CDD:459649 23/58 (40%)
KLF1_2_4_N <321..404 CDD:425360 22/87 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.