DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drgx and si:dkey-43p13.5

DIOPT Version :9

Sequence 1:NP_001097075.2 Gene:Drgx / 5740176 FlyBaseID:FBgn0085369 Length:587 Species:Drosophila melanogaster
Sequence 2:XP_002661267.2 Gene:si:dkey-43p13.5 / 407678 ZFINID:ZDB-GENE-131121-510 Length:315 Species:Danio rerio


Alignment Length:219 Identity:75/219 - (34%)
Similarity:97/219 - (44%) Gaps:48/219 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 PALHPCGPHPPRL---------PTLDYP---------------FAATHPYTSYSYHPAIHDETFV 48
            ||.|.....|.||         |.|.|.               ..|.||   .|.|||.:.:...
Zfish    76 PAAHFFPAFPSRLSSPQIFIPGPLLSYELLRSYLQPEPCKQSLLLAAHP---SSGHPADNIDEPR 137

  Fly    49 RRKQRRNRTTFTLQQLEELETAFAQTHYPDVFTREDLAMKINLTEARVQVWFQNRRAKWRKAERL 113
            ..||||.|..::..||||||..|..|||||:|.||.||::::|.||||||||||||||.|:..:|
Zfish   138 PVKQRRARANYSSWQLEELEKTFQSTHYPDIFMREALALRLDLIEARVQVWFQNRRAKMRRQLKL 202

  Fly   114 KDEQRKRENGESSSSLDKLHDSRESSPDITGEIDDDMDDLPPRQRSHSPLANGQMEQQHSH-SH- 176
                 :.:.||..|..|.  |:|.....|:.          |...::||.......|..:: :| 
Zfish   203 -----QIQTGEQCSQRDT--DTRHPESSISN----------PELHNNSPSPCWDRNQDRTNPAHP 250

  Fly   177 --SHSHSRSPGGGMHLDSSDNERP 198
              |.|..:||...:..|..|.|.|
Zfish   251 KPSPSAIQSPVTDLLQDQQDPEAP 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DrgxNP_001097075.2 Homeobox 56..108 CDD:278475 33/51 (65%)
OAR 428..445 CDD:281777
si:dkey-43p13.5XP_002661267.2 Homeobox 145..197 CDD:278475 33/51 (65%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.