DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drgx and phox2a

DIOPT Version :9

Sequence 1:NP_001097075.2 Gene:Drgx / 5740176 FlyBaseID:FBgn0085369 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_996953.2 Gene:phox2a / 404602 ZFINID:ZDB-GENE-000223-14 Length:280 Species:Danio rerio


Alignment Length:221 Identity:86/221 - (38%)
Similarity:118/221 - (53%) Gaps:47/221 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 HPPRLPTLDYPFAATHPYTSYSYHPAIHDETFVRRKQRRNRTTFTLQQLEELETAFAQTHYPDVF 80
            |.|.      |: :|.||..:|....:::    :|||||.|||||..||:|||..||:|||||::
Zfish    67 HQPA------PY-STVPYKFFSDASGLNE----KRKQRRIRTTFTSSQLKELERVFAETHYPDIY 120

  Fly    81 TREDLAMKINLTEARVQVWFQNRRAKWRKAERLKDEQRKRENGESSSSLDKLHDSRESSPDITGE 145
            |||:||:||:||||||||||||||||:||.||..:.:     ..|||...|..|:|.||.|    
Zfish   121 TREELALKIDLTEARVQVWFQNRRAKFRKQERAANSK-----ASSSSGGKKPSDARSSSED---- 176

  Fly   146 IDDDMDDLPPRQRSHSPLANGQMEQQHSHSHSHSHSRSPGGGMHLDSSDNERPLSSNQLTATPHS 210
             |:.      ::.:.||..:           |.::..|||....|..|....|.|    |.:|.|
Zfish   177 -DES------KESTCSPTPD-----------STANMSSPGARSSLSPSPAPGPAS----TFSPAS 219

  Fly   211 ASQSL-----GSISAGSPSPSGMHRE 231
            .|.:|     .|:.:|:|.|:..|.:
Zfish   220 ISPALKSSPWPSLGSGTPGPTHTHTQ 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DrgxNP_001097075.2 Homeobox 56..108 CDD:278475 40/51 (78%)
OAR 428..445 CDD:281777
phox2aNP_996953.2 Homeobox 96..148 CDD:306543 40/51 (78%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.