DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drgx and PHOX2A

DIOPT Version :9

Sequence 1:NP_001097075.2 Gene:Drgx / 5740176 FlyBaseID:FBgn0085369 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_005160.2 Gene:PHOX2A / 401 HGNCID:691 Length:284 Species:Homo sapiens


Alignment Length:289 Identity:101/289 - (34%)
Similarity:128/289 - (44%) Gaps:94/289 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 PALHPCGPHPPRLPTLDYPFAATH-----PYTS--YSYHP---AIHDETFVRRKQRRNRTTFTLQ 62
            ||....||..|.|.:.:....|..     ||::  |.:.|   .:|:    :|||||.|||||..
Human    40 PAFPAAGPPCPALGSSNCALGALRDHQPAPYSAVPYKFFPEPSGLHE----KRKQRRIRTTFTSA 100

  Fly    63 QLEELETAFAQTHYPDVFTREDLAMKINLTEARVQVWFQNRRAKWRKAERLKDEQ-------RKR 120
            ||:|||..||:|||||::|||:||:||:||||||||||||||||:||.||....:       .|:
Human   101 QLKELERVFAETHYPDIYTREELALKIDLTEARVQVWFQNRRAKFRKQERAASAKGAAGAAGAKK 165

  Fly   121 ENGESSSSLDKLHDSRES----SPDITGEIDDDMDDLPPRQRSHSPLANGQMEQQHSHSHSHSHS 181
            .....||..|   ||:||    :||.|.       .|||      |.|.|               
Human   166 GEARCSSEDD---DSKESTCSPTPDSTA-------SLPP------PPAPG--------------- 199

  Fly   182 RSPGGGMHLDSSDNERPLSSNQLTATPHSASQSLGSISAGSPSPSGMHREREHTPL--------V 238
                             |:|.:|:.:|  ...:|||.....|.|.         ||        .
Human   200 -----------------LASPRLSPSP--LPVALGSGPGPGPGPQ---------PLKGALWAGVA 236

  Fly   239 GGGGQGP-SSPSNSRNTDSPIEVG-GPMS 265
            ||||.|| :..:.......|.|.| ||.|
Human   237 GGGGGGPGAGAAELLKAWQPAESGPGPFS 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DrgxNP_001097075.2 Homeobox 56..108 CDD:278475 40/51 (78%)
OAR 428..445 CDD:281777
PHOX2ANP_005160.2 Homeobox 94..147 CDD:365835 40/52 (77%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 145..284 44/180 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.