DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drgx and Phox2b

DIOPT Version :9

Sequence 1:NP_001097075.2 Gene:Drgx / 5740176 FlyBaseID:FBgn0085369 Length:587 Species:Drosophila melanogaster
Sequence 2:XP_008768389.3 Gene:Phox2b / 364152 RGDID:1560582 Length:314 Species:Rattus norvegicus


Alignment Length:356 Identity:116/356 - (32%)
Similarity:151/356 - (42%) Gaps:127/356 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 PALHP--CGPHPPRLPTL-DY---PFAATHPYTSYSYHPAIHDETFVRRKQRRNRTTFTLQQLEE 66
            |:|.|  |.     |.|| |:   |:||. ||..::.|..:::    :|||||.|||||..||:|
  Rat    58 PSLTPGSCS-----LGTLRDHQSSPYAAV-PYKLFTDHGGLNE----KRKQRRIRTTFTSAQLKE 112

  Fly    67 LETAFAQTHYPDVFTREDLAMKINLTEARVQVWFQNRRAKWRKAER-LKDEQRKRENGES----- 125
            ||..||:|||||::|||:||:||:||||||||||||||||:||.|| ........:||.|     
  Rat   113 LERVFAETHYPDIYTREELALKIDLTEARVQVWFQNRRAKFRKQERAAAAAAAAAKNGSSGKKSD 177

  Fly   126 SSSLDKLHDSRESSPDITGEIDDDMDDLPPRQRSHSPLANGQMEQQHSHSHSHSHSRSPGGGMHL 190
            ||..|:..:::.:.||.||....:.:..|      |..|||                  |||   
  Rat   178 SSRDDESKEAKSTDPDSTGGPGPNPNPTP------SCGANG------------------GGG--- 215

  Fly   191 DSSDNERPLSSNQLTATPHSASQSLGSISAGSPSPSGMHREREHTPLVGGGGQGPSSPSNSRNTD 255
                                          |.|||:|           ..|..||..|.      
  Rat   216 ------------------------------GGPSPAG-----------APGAAGPGGPG------ 233

  Fly   256 SPIEVGGPMSLTTGSRMAASSNNSASSTPTPTTPHAPQMPHSSAAAAAAFGSHIFGNFGGG---- 316
                 |.|   ..|...||::..:|::              ::||||||.|....|..|.|    
  Rat   234 -----GEP---GKGGAAAAAAAAAAAA--------------AAAAAAAAGGLAAAGGPGQGWAPG 276

  Fly   317 ----SNASDSNCG-FRPVLSEQSAVAAAAAA 342
                ::..||..| |..|||.......|.||
  Rat   277 PGPITSIPDSLGGPFASVLSSLQRPNGAKAA 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DrgxNP_001097075.2 Homeobox 56..108 CDD:278475 40/51 (78%)
OAR 428..445 CDD:281777
Phox2bXP_008768389.3 Homeobox 102..155 CDD:395001 40/52 (77%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.