DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drgx and Pph13

DIOPT Version :9

Sequence 1:NP_001097075.2 Gene:Drgx / 5740176 FlyBaseID:FBgn0085369 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_477330.1 Gene:Pph13 / 33239 FlyBaseID:FBgn0023489 Length:357 Species:Drosophila melanogaster


Alignment Length:345 Identity:104/345 - (30%)
Similarity:146/345 - (42%) Gaps:96/345 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 DETFVRRKQRRNRTTFTLQQLEELETAFAQTHYPDVFTREDLAMKINLTEARVQVWFQNRRAKWR 108
            |:..::|||||.||||...||:|||.||.:|||||||.||:||::|:||||||||||||||||||
  Fly     2 DKGTMKRKQRRYRTTFNTLQLQELERAFQRTHYPDVFFREELAVRIDLTEARVQVWFQNRRAKWR 66

  Fly   109 KAERLKDEQRKRENGESSSSLDKLHDSRESSPDITGEIDDDMDDLPPRQRSHSPLANGQMEQQHS 173
            |.|::        .|...       |.:|.:.|:....||.             ...||::    
  Fly    67 KQEKI--------GGLGG-------DYKEGALDLDVSYDDS-------------AVLGQLD---- 99

  Fly   174 HSHSHSHSRSPGGGMHLDSSDNERPLSSNQLTATPHSASQSLGSISAGSPSPS-GMHREREHTPL 237
                   |...|||..|..:.   |.|||.|. ....||...|::|....||: .::...:|..|
  Fly   100 -------SALGGGGTLLPDTP---PQSSNSLD-NELKASYGTGAMSPSRLSPNIFLNLNIDHLGL 153

  Fly   238 VGGGG-------------QGPSSPSNSRNTDSPIEVGGPMS-----LTTGSRMAASSNNSASSTP 284
            ..||.             |..:.|  ..::|:.::...|..     :..||    ||::......
  Fly   154 ERGGSGLSMEWSTYPPQTQAQTHP--QMDSDNQLQQHPPQQHASDPIHAGS----SSHHQQQQQQ 212

  Fly   285 TPTTPHAPQMPHSSAAAAAAFGSHIFGNFGGGSNASD------------------SNCGFRPVLS 331
            .....|.||: |.....||:...    :...||:|.|                  ::|    :||
  Fly   213 HQQEQHNPQL-HPGLEFAASLSL----DMTDGSSAYDEMKFLSVDVDQFTIDSFKADC----ILS 268

  Fly   332 -EQSAVAAAAAAAAAQRSAN 350
             |||.:.|....:....|:|
  Fly   269 MEQSQMQAYGGHSQLVGSSN 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DrgxNP_001097075.2 Homeobox 56..108 CDD:278475 39/51 (76%)
OAR 428..445 CDD:281777
Pph13NP_477330.1 Homeobox 14..66 CDD:278475 39/51 (76%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 55 1.000 Domainoid score I4097
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D143142at50557
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24329
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.