DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drgx and HOXC6

DIOPT Version :10

Sequence 1:NP_001097075.2 Gene:Drgx / 5740176 FlyBaseID:FBgn0085369 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_004494.1 Gene:HOXC6 / 3223 HGNCID:5128 Length:235 Species:Homo sapiens


Alignment Length:93 Identity:30/93 - (32%)
Similarity:47/93 - (50%) Gaps:6/93 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 QRRNRTTFTLQQLEELETAFAQTHYPDVFTRE---DLAMKINLTEARVQVWFQNRRAKWRKAERL 113
            :||.|..::..|..|||..|   |:....||.   ::|..:.|||.::::||||||.||:|...|
Human   141 RRRGRQIYSRYQTLELEKEF---HFNRYLTRRRRIEIANALCLTERQIKIWFQNRRMKWKKESNL 202

  Fly   114 KDEQRKRENGESSSSLDKLHDSRESSPD 141
            .........|.::.||....:.||.:.:
Human   203 TSTLSGGGGGATADSLGGKEEKREETEE 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DrgxNP_001097075.2 Homeodomain 53..109 CDD:459649 23/58 (40%)
OAR 428..446 CDD:461067
HOXC6NP_004494.1 Antp-type hexapeptide 122..127
Homeodomain 142..198 CDD:459649 23/58 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 200..235 6/31 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.