DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drgx and HOXB6

DIOPT Version :10

Sequence 1:NP_001097075.2 Gene:Drgx / 5740176 FlyBaseID:FBgn0085369 Length:587 Species:Drosophila melanogaster
Sequence 2:XP_011523029.1 Gene:HOXB6 / 3216 HGNCID:5117 Length:288 Species:Homo sapiens


Alignment Length:81 Identity:31/81 - (38%)
Similarity:44/81 - (54%) Gaps:12/81 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 RRNRTTFTLQQLEELETAFAQTHYPDVFTRE---DLAMKINLTEARVQVWFQNRRAKWRK----- 109
            ||.|.|:|..|..|||..|   ||....||.   ::|..:.|||.::::||||||.||:|     
Human   211 RRGRQTYTRYQTLELEKEF---HYNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKESKLL 272

  Fly   110 -AERLKDEQRKRENGE 124
             |.:|..|:.:.:..|
Human   273 SASQLSAEEEEEKQAE 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DrgxNP_001097075.2 Homeodomain 53..109 CDD:459649 26/58 (45%)
OAR 428..446 CDD:461067
HOXB6XP_011523029.1 Homeodomain 211..267 CDD:459649 26/58 (45%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.