DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drgx and HOXA6

DIOPT Version :10

Sequence 1:NP_001097075.2 Gene:Drgx / 5740176 FlyBaseID:FBgn0085369 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_076919.1 Gene:HOXA6 / 3203 HGNCID:5107 Length:233 Species:Homo sapiens


Alignment Length:146 Identity:44/146 - (30%)
Similarity:62/146 - (42%) Gaps:35/146 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 PCGPHPPRLPTLDY----PFAATHPYTSYSYHPAIHDETFVRR---------------------- 50
            |.|....|.|. ||    |.....|.:|.....|:|||...|:                      
Human    90 PSGSGKQRGPG-DYLHFSPEQQYKPDSSSGQGKALHDEGADRKYTSPVYPWMQRMNSCAGAVYGS 153

  Fly    51 KQRRNRTTFTLQQLEELETAFAQTHYPDVFTRE---DLAMKINLTEARVQVWFQNRRAKWRKAER 112
            ..||.|.|:|..|..|||..|   |:....||.   ::|..:.|||.::::||||||.||:|..:
Human   154 HGRRGRQTYTRYQTLELEKEF---HFNRYLTRRRRIEIANALCLTERQIKIWFQNRRMKWKKENK 215

  Fly   113 LKDEQRKRENGESSSS 128
            |.:.  .:.:||.|.:
Human   216 LINS--TQPSGEDSEA 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DrgxNP_001097075.2 Homeodomain 53..109 CDD:459649 25/58 (43%)
OAR 428..446 CDD:461067
HOXA6NP_076919.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 89..127 12/37 (32%)
Antp-type hexapeptide 136..141 0/4 (0%)
Homeodomain 156..212 CDD:459649 25/58 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 214..233 4/18 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.