DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drgx and CG11294

DIOPT Version :9

Sequence 1:NP_001097075.2 Gene:Drgx / 5740176 FlyBaseID:FBgn0085369 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001259352.1 Gene:CG11294 / 31807 FlyBaseID:FBgn0030058 Length:261 Species:Drosophila melanogaster


Alignment Length:270 Identity:83/270 - (30%)
Similarity:114/270 - (42%) Gaps:82/270 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 PFAATHP---YTSYSYHPAIHDETFVRRKQRRNRTTFTLQQLEELETAFAQTHYPDVFTREDLAM 87
            ||.:..|   .|.|         .|.||:|||||||||.|||:|||..|.:|||||||.||::|:
  Fly     4 PFISPLPGDLLTEY---------MFGRRRQRRNRTTFTPQQLQELEALFQKTHYPDVFLREEVAL 59

  Fly    88 KINLTEARVQVWFQNRRAKWRKAER---LKDEQRKR-------------------ENGESSSSLD 130
            :|:|:|||||||||||||||||..|   |:|..|.|                   .||.::....
  Fly    60 RISLSEARVQVWFQNRRAKWRKQARLQLLQDAWRMRCLSLGTPPVMGGGAVQGGSGNGATARPPS 124

  Fly   131 KLHDSRESSPDITGEIDDDMDDLPPRQRSHS-PLANGQMEQQHSHSHSHSHS------------- 181
            :..::..|:..     |.::.::.....|.| .:.:...:|||.......|.             
  Fly   125 QTPENLSSASK-----DSELAEVGNGPNSGSFTMMHPAFQQQHQQQQHQGHQQATDQDKLSKTYT 184

  Fly   182 -----RSPGGGMHL--------------DSSDNERP----------LSSNQLTATPHSASQSLGS 217
                 ::|..||.|              |.||:|..          ..|::|........|....
  Fly   185 ELKLYKAPSHGMELGGMAALSGHSDEGSDGSDSEEIDLTSGACIDFSQSSKLQQQQQQQQQQGTQ 249

  Fly   218 ISAGSPSPSG 227
            .:|||...:|
  Fly   250 GAAGSAEANG 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DrgxNP_001097075.2 Homeobox 56..108 CDD:278475 38/51 (75%)
OAR 428..445 CDD:281777
CG11294NP_001259352.1 Homeobox 29..80 CDD:278475 37/50 (74%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 55 1.000 Domainoid score I4097
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24329
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5686
55.010

Return to query results.
Submit another query.