| Sequence 1: | NP_001097075.2 | Gene: | Drgx / 5740176 | FlyBaseID: | FBgn0085369 | Length: | 587 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_571302.1 | Gene: | rx3 / 30474 | ZFINID: | ZDB-GENE-990415-238 | Length: | 292 | Species: | Danio rerio |
| Alignment Length: | 202 | Identity: | 77/202 - (38%) |
|---|---|---|---|
| Similarity: | 107/202 - (52%) | Gaps: | 35/202 - (17%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 42 IHDETFVRRKQRRNRTTFTLQQLEELETAFAQTHYPDVFTREDLAMKINLTEARVQVWFQNRRAK 106
Fly 107 WRKAERLKDEQRKRENGESS------SSLDKLHDSRESSPDITGEI---DDDMDDLP----PRQ- 157
Fly 158 --RSHSP---LANGQMEQQHSHSHSHSHSRSP----GGGMHLDSSDNERP----LSSNQLTATPH 209
Fly 210 SASQSLG 216 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Drgx | NP_001097075.2 | Homeobox | 56..108 | CDD:278475 | 37/51 (73%) |
| OAR | 428..445 | CDD:281777 | |||
| rx3 | NP_571302.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..27 | ||
| Octapeptide motif | 32..39 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 53..72 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 85..107 | 2/10 (20%) | |||
| Homeobox | 110..162 | CDD:278475 | 37/51 (73%) | ||
| OAR | 268..284 | CDD:281777 | 3/15 (20%) | ||
| OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 | 272..285 | 3/14 (21%) | |||
| Nuclear localization signal. /evidence=ECO:0000255 | 278..282 | 0/3 (0%) | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D454642at33208 | |
| OrthoFinder | 1 | 1.000 | - | - | FOG0000011 | |
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.920 | |||||