DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drgx and dharma

DIOPT Version :9

Sequence 1:NP_001097075.2 Gene:Drgx / 5740176 FlyBaseID:FBgn0085369 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_571054.1 Gene:dharma / 30170 ZFINID:ZDB-GENE-990415-22 Length:192 Species:Danio rerio


Alignment Length:150 Identity:48/150 - (32%)
Similarity:67/150 - (44%) Gaps:32/150 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFCYQCP--PALHPCGPHPPRLPTLDY----------PFAATHPYTSYSYHPAIHDETFVRRKQR 53
            |..:.||  |.::.|     .:|...|          |:|.....|:.:     |..|..:|.:.
Zfish    62 MVNFPCPSWPGMYCC-----CVPVSYYQSTYYAGQPWPYAVAGCETAEN-----HYHTIAQRPRG 116

  Fly    54 RNRTTFTLQQLEELETAFAQTHYPDVFTREDLAMKINLTEARVQVWFQNRRAKWRKAERLKDEQR 118
            |.||.||..|.|:||..||.|.||.|.||.:||....|:|..|:|||:||||:.::.....|:..
Zfish   117 RIRTVFTDNQTEQLERLFAVTDYPTVETRAELAQNTGLSEETVRVWFKNRRARRKRQTTCADKHA 181

  Fly   119 KRENGESSSSLDKLHDSRES 138
            .|          .|.|.:||
Zfish   182 NR----------ALEDHQES 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DrgxNP_001097075.2 Homeobox 56..108 CDD:278475 28/51 (55%)
OAR 428..445 CDD:281777
dharmaNP_571054.1 Homeobox 119..171 CDD:278475 28/51 (55%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.