DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drgx and Rhox11

DIOPT Version :9

Sequence 1:NP_001097075.2 Gene:Drgx / 5740176 FlyBaseID:FBgn0085369 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001020044.1 Gene:Rhox11 / 298346 RGDID:1564332 Length:215 Species:Rattus norvegicus


Alignment Length:96 Identity:36/96 - (37%)
Similarity:51/96 - (53%) Gaps:12/96 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 DETFVRRKQR--RNRTTFTLQQLEELETAFAQTHYPDVFTREDLAMKINLTEARVQVWFQNRRAK 106
            |||..:...|  |....||..||.|::..|.:|.|||.|.|::||..:|:.|.:|:.||.|:|||
  Rat    86 DETSEQLLFRIPRKPYKFTPGQLWEMQAVFEETQYPDAFRRKELAELMNVDEQKVKDWFNNKRAK 150

  Fly   107 WRKAER----------LKDEQRKRENGESSS 127
            .||.:|          .:||.|.:...||.:
  Rat   151 LRKIQREILKGKIITPTQDELRMKTLVESKN 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DrgxNP_001097075.2 Homeobox 56..108 CDD:278475 23/51 (45%)
OAR 428..445 CDD:281777
Rhox11NP_001020044.1 homeodomain 97..155 CDD:238039 26/57 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.