DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drgx and Alx1

DIOPT Version :9

Sequence 1:NP_001097075.2 Gene:Drgx / 5740176 FlyBaseID:FBgn0085369 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_037053.1 Gene:Alx1 / 25401 RGDID:2273 Length:326 Species:Rattus norvegicus


Alignment Length:259 Identity:82/259 - (31%)
Similarity:108/259 - (41%) Gaps:73/259 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 DETFVRRKQRRNRTTFTLQQLEELETAFAQTHYPDVFTREDLAMKINLTEARVQVWFQNRRAKWR 108
            |......|:||:|||||..||||||..|.:||||||:.||.||::..||||||||||||||||||
  Rat   124 DSNVSSSKKRRHRTTFTSLQLEELEKVFQKTHYPDVYVREQLALRTELTEARVQVWFQNRRAKWR 188

  Fly   109 KAERLKDEQRKRENGESSSSLDKLHDSRESSPDITGEIDDDMDDLPPRQRSHSPLANGQMEQQHS 173
            |.||....|:.:.:..::..:..|                      ||..|:..:.|        
  Rat   189 KRERYGQIQQAKSHFAATYDISVL----------------------PRTDSYPQIQN-------- 223

  Fly   174 HSHSHSHSRSPGGGMHLDSSDNERPLSSNQLTATPHSASQSLGSISAGSPSPSGMHREREHTPLV 238
                :..:.:..||..:.|....|..||   ..||:|.|....|...|.   |....:..|.|| 
  Rat   224 ----NLWAGNTSGGSVVTSCMLPRDASS---CMTPYSHSPRTDSSYTGF---SNHQNQFGHVPL- 277

  Fly   239 GGGGQGPSSPSNSRNTDSPIEVGGPMSLTTGSRMAASSNNSASSTPTPTTPHAPQMPHSSAAAA 302
                       |:..||         ||.||     ::|..|..|       .|:....|::.|
  Rat   278 -----------NNFFTD---------SLLTG-----TTNGHAFET-------KPEFERRSSSIA 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DrgxNP_001097075.2 Homeobox 56..108 CDD:278475 38/51 (75%)
OAR 428..445 CDD:281777
Alx1NP_037053.1 Homeobox 135..188 CDD:278475 38/52 (73%)
Transactivation domain. /evidence=ECO:0000269|PubMed:12390248 192..326 36/191 (19%)
OAR 302..319 CDD:281777 2/8 (25%)
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 306..319 1/4 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D454642at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.