DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drgx and ceh-8

DIOPT Version :9

Sequence 1:NP_001097075.2 Gene:Drgx / 5740176 FlyBaseID:FBgn0085369 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_492246.2 Gene:ceh-8 / 191617 WormBaseID:WBGene00000433 Length:276 Species:Caenorhabditis elegans


Alignment Length:267 Identity:78/267 - (29%)
Similarity:110/267 - (41%) Gaps:71/267 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 RKQRRNRTTFTLQQLEELETAFAQTHYPDVFTREDLAMKINLTEARVQVWFQNRRAKWRKAERLK 114
            :||||||||||..||..||.||.:||||||:.||.||.|:.|.|.||||||||||||:|:.|: :
 Worm    58 KKQRRNRTTFTTFQLHALEAAFDKTHYPDVYARETLAAKVQLPEVRVQVWFQNRRAKFRRQEK-Q 121

  Fly   115 DEQRKRENGESSSSLDKLHDSRESSPDITGEIDDDMDD---LPPRQRSHSPLANGQMEQ------ 170
            |.|     ||...||      :::.|..:...::..|.   |||.....|...||..::      
 Worm   122 DCQ-----GEEKHSL------KDTMPSWSWMSENKTDTPPMLPPANTLSSTHNNGISDEFFKTSE 175

  Fly   171 ----------QHSHSHSHSHSRSPGGGMHLDSSDNERPLSSNQLTATPHSASQSLGSISAGSPSP 225
                      ::.....::|....|...||:..|:::               :|:...|..:||.
 Worm   176 GKEVYGFPFAEYGTPADNTHVSKTGNVFHLNFEDSDK---------------KSMKKESPQTPST 225

  Fly   226 SGMHREREHTPLVGGGGQGPSSPSNSRNTDSPIEVGGPMSLTTGSRMAASSNNSASSTPTPTTPH 290
            |.......|.|.:                        |..:...| .:.:.|......|.|....
 Worm   226 SSPFISEYHPPFI------------------------PYYIPNQS-FSNAFNQYPMPFPYPIHFE 265

  Fly   291 APQMPHS 297
            .||:.||
 Worm   266 PPQLTHS 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DrgxNP_001097075.2 Homeobox 56..108 CDD:278475 36/51 (71%)
OAR 428..445 CDD:281777
ceh-8NP_492246.2 Homeobox 64..116 CDD:278475 36/51 (71%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D454642at33208
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.