DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drgx and ceh-54

DIOPT Version :9

Sequence 1:NP_001097075.2 Gene:Drgx / 5740176 FlyBaseID:FBgn0085369 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001338798.1 Gene:ceh-54 / 188474 WormBaseID:WBGene00020485 Length:221 Species:Caenorhabditis elegans


Alignment Length:265 Identity:67/265 - (25%)
Similarity:98/265 - (36%) Gaps:102/265 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 DYPFAATHPYT---SYSYHPAIHDETFVRRKQRRNRTTFTLQQLEELETAFAQTHYPDVFTREDL 85
            |..|..|...|   |.:::|         .:::|||.||...|::|:|..||:..|||..:||.|
 Worm    23 DTQFETTKKITRKRSNNFNP---------DRKKRNRITFDANQIDEMEKVFAENQYPDTMSREKL 78

  Fly    86 AMKINLTEARVQVWFQNRRAKWRKAERLKDEQRKRENGESSSSLDKLHDSRESSPDITGEIDDDM 150
            |.||.|.|.|||:||||||||:|:      ||::                       ||...:  
 Worm    79 ANKIQLHEERVQIWFQNRRAKYRR------EQKQ-----------------------TGHPYE-- 112

  Fly   151 DDLPPRQRSHSPLANGQMEQQHSHSHSHSHSRSPGGGMHLDSSDNERPLSSNQLTATPHSASQSL 215
               ||                       |.:::|.|       :.|:......||          
 Worm   113 ---PP-----------------------SITKNPTG-------EKEKTQDCTTLT---------- 134

  Fly   216 GSISAGSPSPSGMHRER----EHTPLVGGGGQGPSSPSNSRNTDSPIEVGGPMSLTTGSRMAASS 276
               ||.||.||.:..:.    |..|.:|         :.|.|......:...:::...:...||.
 Worm   135 ---SASSPGPSNLSNDTLVSIEMAPKIG---------TKSVNLFPDQALSNTLNMIINANKNASE 187

  Fly   277 NNSAS 281
            ||..|
 Worm   188 NNYES 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DrgxNP_001097075.2 Homeobox 56..108 CDD:278475 30/51 (59%)
OAR 428..445 CDD:281777
ceh-54NP_001338798.1 Homeobox 49..102 CDD:365835 30/52 (58%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.