DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drgx and Pdx1

DIOPT Version :10

Sequence 1:NP_001097075.2 Gene:Drgx / 5740176 FlyBaseID:FBgn0085369 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_032840.1 Gene:Pdx1 / 18609 MGIID:102851 Length:284 Species:Mus musculus


Alignment Length:163 Identity:47/163 - (28%)
Similarity:69/163 - (42%) Gaps:32/163 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PPALHPCGPHP-----PRLPTLDYPF---AATHPYT------SYSYHPAIHDETFVRRKQRRNRT 57
            ||...|.|..|     |....|.:|:   ...|.:.      :|:..|         .:.:|.||
Mouse    97 PPGPFPNGTEPGGLEEPNRVQLPFPWMKSTKAHAWKGQWAGGAYTAEP---------EENKRTRT 152

  Fly    58 TFTLQQLEELETAFAQTHYPDVFTREDLAMKINLTEARVQVWFQNRRAKWRKAERLKDEQRKREN 122
            .:|..||.|||..|....|.....|.:||:.:||||..:::||||||.||:     |:|.:||.:
Mouse   153 AYTRAQLLELEKEFLFNKYISRPRRVELAVMLNLTERHIKIWFQNRRMKWK-----KEEDKKRSS 212

  Fly   123 GESSSSLDKLHDSRESSPDITGEIDDDMDDLPP 155
            |..|..    ....|...|......:::..:||
Mouse   213 GTPSGG----GGGEEPEQDCAVTSGEELLAVPP 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DrgxNP_001097075.2 Homeodomain 53..109 CDD:459649 26/55 (47%)
OAR 428..446 CDD:461067
Pdx1NP_032840.1 Transactivation domain. /evidence=ECO:0000250 13..73
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 30..116 6/18 (33%)
Antp-type hexapeptide 119..124 1/4 (25%)
Homeodomain 148..204 CDD:459649 26/60 (43%)
Nuclear localization signal 198..204 4/10 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 202..284 11/49 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.