DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drgx and dsc-1

DIOPT Version :10

Sequence 1:NP_001097075.2 Gene:Drgx / 5740176 FlyBaseID:FBgn0085369 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_510497.1 Gene:dsc-1 / 181599 WormBaseID:WBGene00001096 Length:310 Species:Caenorhabditis elegans


Alignment Length:168 Identity:47/168 - (27%)
Similarity:71/168 - (42%) Gaps:45/168 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YQCPPALHP-CGPHP----PRLPTLDY-----PFAATHPYTSYSY-HPAIHDETFVRRK------ 51
            :.||..:.| ...|.    |:|...|:     |    |.::.::| :..|.|.::....      
 Worm    96 FDCPTTVSPISSAHETGQLPQLSPYDHIGNQDP----HMFSPHAYGNSMIPDNSYFENASRSISA 156

  Fly    52 -----------------------QRRNRTTFTLQQLEELETAFAQTHYPDVFTREDLAMKINLTE 93
                                   :||.||.||..|...||.:|.::||||...::.:|..:.:.|
 Worm   157 PNVGNSTLNPSLMSSDNAQSCGGRRRFRTNFTELQSTFLEDSFKESHYPDHKAKKYMADFLKIPE 221

  Fly    94 ARVQVWFQNRRAKWRKAE-RLKDEQRKRENGESSSSLD 130
            .|:.|||||||||||:.| |.:|..|.......|:|.|
 Worm   222 DRITVWFQNRRAKWRRKEHRQRDRTRNESFSGGSNSFD 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DrgxNP_001097075.2 Homeodomain 53..109 CDD:459649 27/55 (49%)
OAR 428..446 CDD:461067
dsc-1NP_510497.1 Homeodomain 181..237 CDD:459649 27/55 (49%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.