DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drgx and DLX4

DIOPT Version :10

Sequence 1:NP_001097075.2 Gene:Drgx / 5740176 FlyBaseID:FBgn0085369 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_612138.1 Gene:DLX4 / 1748 HGNCID:2917 Length:240 Species:Homo sapiens


Alignment Length:112 Identity:38/112 - (33%)
Similarity:56/112 - (50%) Gaps:14/112 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 CYQCPPALHP--CGP--HPPRLPT-LDYPFAATHPYTSYSYHPAIHDETFVRRKQRRNRTTFTLQ 62
            |.| |.||..  |||  ||..|.. .:.|..:..|.......||        :|.|:.||.::..
Human    72 CQQ-PAALSQPLCGPAEHPQELEADSEKPRLSPEPSERRPQAPA--------KKLRKPRTIYSSL 127

  Fly    63 QLEELETAFAQTHYPDVFTREDLAMKINLTEARVQVWFQNRRAKWRK 109
            ||:.|...|..|.|..:..|..||.::.||:.:|::||||:|:|::|
Human   128 QLQHLNQRFQHTQYLALPERAQLAAQLGLTQTQVKIWFQNKRSKYKK 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DrgxNP_001097075.2 Homeodomain 53..109 CDD:459649 21/55 (38%)
OAR 428..446 CDD:461067
DLX4NP_612138.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 80..120 12/47 (26%)
Homeodomain 118..174 CDD:459649 21/55 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.