DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drgx and ceh-17

DIOPT Version :10

Sequence 1:NP_001097075.2 Gene:Drgx / 5740176 FlyBaseID:FBgn0085369 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_491393.1 Gene:ceh-17 / 172059 WormBaseID:WBGene00000440 Length:237 Species:Caenorhabditis elegans


Alignment Length:92 Identity:57/92 - (61%)
Similarity:74/92 - (80%) Gaps:8/92 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 RRKQRRNRTTFTLQQLEELETAFAQTHYPDVFTREDLAMKINLTEARVQVWFQNRRAKWRKAE-- 111
            ||||||.|||||..||:|||.:|.:|||||::|||::||:|:||||||||||||||||:||.|  
 Worm   146 RRKQRRIRTTFTSGQLKELERSFCETHYPDIYTREEIAMRIDLTEARVQVWFQNRRAKYRKQEKI 210

  Fly   112 -RLKDEQR---KRENGESSSSLDKLHD 134
             |:|||:.   |:|.|:  .||:::.|
 Worm   211 RRVKDEEEDPLKKEPGQ--ISLEEIID 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DrgxNP_001097075.2 Homeodomain 53..109 CDD:459649 40/55 (73%)
OAR 428..446 CDD:461067
ceh-17NP_491393.1 DLL_N 19..112 CDD:463567
Homeodomain 150..206 CDD:459649 40/55 (73%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.