DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drgx and ceh-45

DIOPT Version :9

Sequence 1:NP_001097075.2 Gene:Drgx / 5740176 FlyBaseID:FBgn0085369 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_490823.1 Gene:ceh-45 / 171689 WormBaseID:WBGene00022837 Length:229 Species:Caenorhabditis elegans


Alignment Length:177 Identity:63/177 - (35%)
Similarity:92/177 - (51%) Gaps:32/177 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YQCPPALHP-----CGPHPPRLPTLDYPFAATHPYTSYSYHPAIHDETFVRRKQRRNRTTFTLQQ 63
            :|..||.:|     |||..|       ||.|  ||         |.:.:..|::||:||.|:.:|
 Worm    74 WQFHPANYPFFSMLCGPLMP-------PFMA--PY---------HHQHYASRRKRRHRTIFSEEQ 120

  Fly    64 LEELETAFAQTHYPDVFTREDLAMKINLTEARVQVWFQNRRAKWRKAERLKDEQRKRENGESSSS 128
            |..|||.|:.|||||..|||:||::.:|.|.||:|||:|||||.||.:  ||:.|..::....|.
 Worm   121 LNILETTFSTTHYPDATTREELAVQCSLKEERVEVWFKNRRAKERKQK--KDDSRTSKHSGDDSE 183

  Fly   129 LDKLHDSRESSPDITGEIDDDMDDLPPRQRSHSPLANGQMEQQHSHS 175
            .|      ||..| |.::.....:....:.:.||.:...::..||.:
 Worm   184 CD------ESDED-TRKVKRIKRENSSGKETSSPESKASLKTSHSEN 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DrgxNP_001097075.2 Homeobox 56..108 CDD:278475 31/51 (61%)
OAR 428..445 CDD:281777
ceh-45NP_490823.1 Homeobox 112..166 CDD:365835 31/53 (58%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.