DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drgx and ARX

DIOPT Version :9

Sequence 1:NP_001097075.2 Gene:Drgx / 5740176 FlyBaseID:FBgn0085369 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_620689.1 Gene:ARX / 170302 HGNCID:18060 Length:562 Species:Homo sapiens


Alignment Length:425 Identity:115/425 - (27%)
Similarity:146/425 - (34%) Gaps:214/425 - (50%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 DETFVRRKQRRNRTTFTLQQLEELETAFAQTHYPDVFTREDLAMKINLTEARVQVWFQNRRAKWR 108
            :|..::|||||.|||||..||||||.||.:||||||||||:|||:::||||||||||||||||||
Human   320 EEGLLKRKQRRYRTTFTSYQLEELERAFQKTHYPDVFTREELAMRLDLTEARVQVWFQNRRAKWR 384

  Fly   109 KAERLKDEQRKRENGESSSSLDKLHDSRESSPDITGEIDDDMDDLPPRQRSHSPLANGQMEQQHS 173
            |.|:...:..                                   ||......||          
Human   385 KREKAGAQTH-----------------------------------PPGLPFPGPL---------- 404

  Fly   174 HSHSHSHSRSPGGGMHLDSSDNERPLSSNQLTATPHSASQSLGSISAGSPSPSGMHREREHTPLV 238
               |.:|..||    :||:|                                             
Human   405 ---SATHPLSP----YLDAS--------------------------------------------- 417

  Fly   239 GGGGQGPSSPSNSRNTDSPIEVGGPMSLTTGSRMAASSNNSASSTPTPTTPHAPQMPHSSAAAAA 303
                                                           |..||.|.:..:..||||
Human   418 -----------------------------------------------PFPPHHPALDSAWTAAAA 435

  Fly   304 AFGSHIFGNFGGGSNASDSNCGFRPVLSEQSAVAAAAAAAAAQRSANHPPLFLPPHL-----AAQ 363
            |                              |.||..:......||:.||...|..|     ||.
Human   436 A------------------------------AAAAFPSLPPPPGSASLPPSGAPLGLSTFLGAAV 470

  Fly   364 FTHQPLFPGLKGVSP-FQSLCSCCSLKPPPPPGSSVVAPLSIPVSSSSAASSPESPKSSGQGSV- 426
            |.| |.|     :|| |..|             .|.:|||:   |:|:||:....|..:.:|:| 
Human   471 FRH-PAF-----ISPAFGRL-------------FSTMAPLT---SASTAAALLRQPTPAVEGAVA 513

  Fly   427 -----------HDPRSNSVAELRRKAQEHSAALLQ 450
                       .|.|::|:|.||.||:||:|.|.|
Human   514 SGALADPATAAADRRASSIAALRLKAKEHAAQLTQ 548

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DrgxNP_001097075.2 Homeobox 56..108 CDD:278475 42/51 (82%)
OAR 428..445 CDD:281777 9/16 (56%)
ARXNP_620689.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 50..81
GCG-encoded polyalanine repeat 102..111
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 118..255
Homeobox 332..385 CDD:395001 43/52 (83%)
OAR 526..544 CDD:397759 10/17 (59%)
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 530..543 7/12 (58%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D454642at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.