DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drgx and RHOXF1

DIOPT Version :9

Sequence 1:NP_001097075.2 Gene:Drgx / 5740176 FlyBaseID:FBgn0085369 Length:587 Species:Drosophila melanogaster
Sequence 2:XP_011529583.1 Gene:RHOXF1 / 158800 HGNCID:29993 Length:212 Species:Homo sapiens


Alignment Length:120 Identity:41/120 - (34%)
Similarity:56/120 - (46%) Gaps:38/120 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PPALHPC-----GPHPPRLPTLDYPFAATHPYTSYSYHPAIHDETFVRRKQRRNRTTFTLQQLEE 66
            ||...|.     ||.|..:                              :.|..||.|||.|:||
Human   111 PPPEEPAQAAMEGPQPENM------------------------------QPRTRRTKFTLLQVEE 145

  Fly    67 LETAFAQTHYPDVFTREDLAMKINLTEARVQVWFQNRRAKWRKAER---LKDEQR 118
            ||:.|..|.||||.||.:||..:.:||.:|:|||:|:||:.|:.:|   |.:|.|
Human   146 LESVFRHTQYPDVPTRRELAENLGVTEDKVRVWFKNKRARCRRHQRELMLANELR 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DrgxNP_001097075.2 Homeobox 56..108 CDD:278475 29/51 (57%)
OAR 428..445 CDD:281777
RHOXF1XP_011529583.1 homeodomain 132..190 CDD:238039 31/57 (54%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.