DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drgx and Hoxc4

DIOPT Version :10

Sequence 1:NP_001097075.2 Gene:Drgx / 5740176 FlyBaseID:FBgn0085369 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_038581.2 Gene:Hoxc4 / 15423 MGIID:96195 Length:264 Species:Mus musculus


Alignment Length:179 Identity:51/179 - (28%)
Similarity:79/179 - (44%) Gaps:43/179 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 HP------CGPHP---------PRLPTLDYPFAATHPYTSYSYHPAIH-----------DETFVR 49
            ||      |.|.|         |..|....| |..||.::.|..|.::           :..:..
Mouse    90 HPEKSQPLCEPAPLSGTSASPSPAPPACSQP-APDHPSSAASKQPIVYPWMKKIHVSTVNPNYNG 153

  Fly    50 RKQRRNRTTFTLQQLEELETAFAQTHYPDVFTRE---DLAMKINLTEARVQVWFQNRRAKWRKAE 111
            .:.:|:||.:|.||:.|||..|   ||....||.   ::|..:.|:|.::::||||||.||:|..
Mouse   154 GEPKRSRTAYTRQQVLELEKEF---HYNRYLTRRRRIEIAHSLCLSERQIKIWFQNRRMKWKKDH 215

  Fly   112 RLKDEQRKR--ENGESSSSLDKLHDSRESSPDITGEIDDDMDDLPPRQR 158
            ||.:.:.:.  ..|.:.|:|.      .::|. |.| |......||.|:
Mouse   216 RLPNTKVRSAPPAGAAPSTLS------AATPG-TSE-DHSQSATPPEQQ 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DrgxNP_001097075.2 Homeodomain 53..109 CDD:459649 25/58 (43%)
OAR 428..446 CDD:461067
Hoxc4NP_038581.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 19..130 11/40 (28%)
Antp-type hexapeptide 135..140 0/4 (0%)
Homeodomain 157..213 CDD:459649 25/58 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 214..264 12/51 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.